DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33702 and CG33766

DIOPT Version :9

Sequence 1:NP_001027120.1 Gene:CG33702 / 3771932 FlyBaseID:FBgn0053702 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001027140.1 Gene:CG33766 / 3772380 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster


Alignment Length:155 Identity:38/155 - (24%)
Similarity:59/155 - (38%) Gaps:37/155 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IILFSSTLGAHFR--FTNF----KCISLDPEFAVVKECILKMVRRSVVGINFHIAIKYSQPINKI 71
            |:|..|..|...|  |:||    |...::.||.        ::|..|.|:..           .|
  Fly    25 ILLLESQCGNFNRSYFSNFTMFVKNSQMNMEFF--------LLRVLVPGVTM-----------DI 70

  Fly    72 EFNLSIFRKSNMYRLFLVNHTIDFCYYM--RRPEQY-PIFYMFHDSLMAATNANHSCPYTEKDIY 133
            ||.:|:.......::|  .:|:|.|..:  ||...: ..|..|.||    .|....||......|
  Fly    71 EFFISMQNSYGFQKIF--QYTLDMCSLLAQRRNNMFKKWFATFFDS----GNFKKYCPVEPNFYY 129

  Fly   134 VKKMTFNDKTLKDLLSFLPVGEYKL 158
            :|...:|...:.   .||..|:|::
  Fly   130 LKNYNYNTLFIP---KFLYAGKYRV 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33702NP_001027120.1 DUF1091 73..158 CDD:284008 22/87 (25%)
CG33766NP_001027140.1 DUF1091 68..151 CDD:284008 24/102 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447830
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.