DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33702 and CG33631

DIOPT Version :9

Sequence 1:NP_001027120.1 Gene:CG33702 / 3771932 FlyBaseID:FBgn0053702 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001027167.1 Gene:CG33631 / 3771784 FlyBaseID:FBgn0053631 Length:195 Species:Drosophila melanogaster


Alignment Length:197 Identity:45/197 - (22%)
Similarity:79/197 - (40%) Gaps:38/197 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFLAITNVFLTIILFSSTLGAHFRFTNFKCISLDPEFAVVKECILKMVRRSVVG---------- 55
            |||:.: ::|..:....:..|     |:.|.:..|.|...|::.||::...::.|          
  Fly     1 MKFVRL-SIFFPLFYIVNGNG-----TDHKSLWDDDEDNEVQKPILRIHHINIFGDSRFMKALSY 59

  Fly    56 -----INFHIAIKYSQPI--NKIEFNLSI----FRKSNMYRLFLVNHTIDFCYYMRRPEQYPIFY 109
                 :.|.|.|...:.:  |.:.||:.|    ..::|...| |....:|.|.:.....:.|:..
  Fly    60 IDETRLKFTIFISLREELGSNFLTFNIKIRVRPTGRTNFVTL-LQMRDLDLCGFFTEFRKNPMMK 123

  Fly   110 MFHDSLMAATNANHSCPYTEKDIYVKKMTFNDKTLKDLL-SFLPVGEYKL---VVSVGAFGVWRL 170
            .|..|.|..::. ..||....:..||.:     ::||:. ..|..|.||.   |:...|..|:.|
  Fly   124 YFLQSEMQLSDI-IVCPVRVGNYSVKNV-----SVKDIYPQVLQNGIYKFFVEVIEATAEKVFAL 182

  Fly   171 QV 172
            ||
  Fly   183 QV 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33702NP_001027120.1 DUF1091 73..158 CDD:284008 21/89 (24%)
CG33631NP_001027167.1 DUF1091 84..167 CDD:284008 21/89 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.