DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33702 and CG33137

DIOPT Version :9

Sequence 1:NP_001027120.1 Gene:CG33702 / 3771932 FlyBaseID:FBgn0053702 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster


Alignment Length:143 Identity:33/143 - (23%)
Similarity:65/143 - (45%) Gaps:13/143 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 FRFTNFKCISLDPEFAVVKECILKMV--RRSVVGINFHIAIKYSQPINKIEFNLSIFRK--SNMY 84
            ::..|.:| |..|.|:....|.::.:  .::|..::.::.    :|:..|.....|.:|  ||.:
  Fly    14 YKLKNIEC-STVPGFSANASCHIRAINWNKAVAEMDVYLL----RPLYNITIRFQILKKDYSNKF 73

  Fly    85 RLFLVNHTIDFCYYMRRPEQYPIFYMFHDSLMAATNANHSCPYTEKDIYVKKMTFNDKTLKDLLS 149
            :.|||:..|:.|..:.|....|...:........:|.|||||| ...:..:....|:..|.::  
  Fly    74 QPFLVDVVINMCDALSRRSFIPYGLIILKIARTFSNFNHSCPY-RGHLMARGAYLNESYLPNV-- 135

  Fly   150 FLPVGEYKLVVSV 162
             .|:|.||..:::
  Fly   136 -FPLGFYKFNITI 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33702NP_001027120.1 DUF1091 73..158 CDD:284008 23/86 (27%)
CG33137NP_788343.3 DM8 73..164 CDD:214778 20/79 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472435
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
54.840

Return to query results.
Submit another query.