DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33702 and CG33476

DIOPT Version :9

Sequence 1:NP_001027120.1 Gene:CG33702 / 3771932 FlyBaseID:FBgn0053702 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_995798.2 Gene:CG33476 / 2768727 FlyBaseID:FBgn0053476 Length:165 Species:Drosophila melanogaster


Alignment Length:93 Identity:21/93 - (22%)
Similarity:41/93 - (44%) Gaps:10/93 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 IEFNLSIFR-KSNMYRLFLVNHTIDFCYYMRRPEQYPIFYMFHDSLMAATNANHSCPYTEKDIYV 134
            |:|.:.:.: |..||::    ...|.|.::..|....:|...:..|: ...:..|||......|:
  Fly    59 IDFAVRVVKTKRVMYKV----DNFDGCQFLMNPLMNRVFGTVYKRLV-VNGSFFSCPIKPGVYYI 118

  Fly   135 KKMTFNDKTLKDLLSFLPVGEYKLVVSV 162
            :    |:.::..|..|.|.|.|::.:.|
  Fly   119 R----NEGSVAMLPVFQPPGRYQITMRV 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33702NP_001027120.1 DUF1091 73..158 CDD:284008 19/85 (22%)
CG33476NP_995798.2 DUF1091 57..138 CDD:284008 20/87 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.