powered by:
Protein Alignment CG33672 and BOL3
DIOPT Version :9
Sequence 1: | NP_001027413.1 |
Gene: | CG33672 / 3771915 |
FlyBaseID: | FBgn0061360 |
Length: | 86 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_009353.1 |
Gene: | BOL3 / 851251 |
SGDID: | S000000044 |
Length: | 118 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 64 |
Identity: | 24/64 - (37%) |
Similarity: | 40/64 - (62%) |
Gaps: | 0/64 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 DSKYLEEKLKRELQTEYVSVTDESDGCGGKFSAVIVSPAFSGKTLLQKHRLVNSTLAEELKEIH 68
:.|.:.:||::||:.|...|.|.|.|||..|:..|.|..|:|.:|:::|:|||..|.:::...|
Yeast 38 EEKMITDKLQQELEPEVCKVQDVSGGCGSMFAINITSKKFNGLSLIKQHQLVNRILRDDISRWH 101
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG33672 | NP_001027413.1 |
BolA |
13..79 |
CDD:396332 |
22/56 (39%) |
BOL3 | NP_009353.1 |
BolA |
33..110 |
CDD:223349 |
24/64 (38%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0271 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R1811 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.840 |
|
Return to query results.
Submit another query.