DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33672 and AT5G09830

DIOPT Version :9

Sequence 1:NP_001027413.1 Gene:CG33672 / 3771915 FlyBaseID:FBgn0061360 Length:86 Species:Drosophila melanogaster
Sequence 2:NP_568217.1 Gene:AT5G09830 / 830843 AraportID:AT5G09830 Length:93 Species:Arabidopsis thaliana


Alignment Length:74 Identity:34/74 - (45%)
Similarity:50/74 - (67%) Gaps:1/74 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LEEKLKRELQTEYVSVTDESDGCGGKFSAVIVSPAFSGKTLLQKHRLVNSTLAEELKEIHAFS-Q 72
            :|..|..:|:..::.|.|.|.|||..|...:||..|.||.||::||:||:.|.||:|||||.| :
plant     7 VEASLTSKLKPIHLEVIDISGGCGSSFEVEVVSEQFEGKRLLERHRMVNAALEEEMKEIHALSIK 71

  Fly    73 KSYTPEEWE 81
            |:.||::|:
plant    72 KAQTPQQWK 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33672NP_001027413.1 BolA 13..79 CDD:396332 32/66 (48%)
AT5G09830NP_568217.1 BolA 11..78 CDD:396332 32/66 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 66 1.000 Domainoid score I3594
eggNOG 1 0.900 - - E1_COG0271
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I2448
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000905
OrthoInspector 1 1.000 - - oto3129
orthoMCL 1 0.900 - - OOG6_103994
Panther 1 1.100 - - LDO PTHR12735
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4383
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.820

Return to query results.
Submit another query.