DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33672 and CPSUFE

DIOPT Version :10

Sequence 1:NP_001027413.1 Gene:CG33672 / 3771915 FlyBaseID:FBgn0061360 Length:86 Species:Drosophila melanogaster
Sequence 2:NP_194380.1 Gene:CPSUFE / 828756 AraportID:AT4G26500 Length:371 Species:Arabidopsis thaliana


Alignment Length:86 Identity:32/86 - (37%)
Similarity:45/86 - (52%) Gaps:15/86 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LEEKLKRELQTEYVSVTDES---------DGCGG-----KFSAVIVSPAFSGKTLLQKHRLVNST 59
            :.|||::||....:.|.|.|         .|..|     .|:..|||.||.||:|:::|||:...
plant   285 IREKLEKELDPVELEVEDVSYQHAGHAAVRGSAGDDGETHFNLRIVSDAFQGKSLVKRHRLIYDL 349

  Fly    60 LAEELKE-IHAFSQKSYTPEE 79
            |.:|||. :||.|..:.||.|
plant   350 LQDELKSGLHALSIVAKTPAE 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33672NP_001027413.1 BolA 1..82 CDD:440041 32/86 (37%)
CPSUFENP_194380.1 SufE 83..214 CDD:441769
BolA 284..370 CDD:440041 31/84 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.