DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33672 and Bola2

DIOPT Version :9

Sequence 1:NP_001027413.1 Gene:CG33672 / 3771915 FlyBaseID:FBgn0061360 Length:86 Species:Drosophila melanogaster
Sequence 2:NP_780312.1 Gene:Bola2 / 66162 MGIID:1913412 Length:86 Species:Mus musculus


Alignment Length:80 Identity:40/80 - (50%)
Similarity:55/80 - (68%) Gaps:1/80 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YLEEKLKRELQTEYVSVTDES-DGCGGKFSAVIVSPAFSGKTLLQKHRLVNSTLAEELKEIHAFS 71
            ||.|||:::|:.|:|.|.|.: :.|...|..::||..|.||.|||:|||||..|||||..||||.
Mouse     7 YLREKLRQDLEAEHVEVEDTTLNRCATSFRVLVVSAKFEGKPLLQRHRLVNECLAEELPHIHAFE 71

  Fly    72 QKSYTPEEWEKVKAQ 86
            ||:.|||:|.:.:.:
Mouse    72 QKTLTPEQWTRQRRE 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33672NP_001027413.1 BolA 13..79 CDD:396332 34/66 (52%)
Bola2NP_780312.1 BolA 12..79 CDD:334650 34/66 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849822
Domainoid 1 1.000 71 1.000 Domainoid score I9435
eggNOG 1 0.900 - - E1_COG0271
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I5164
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52896
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000905
OrthoInspector 1 1.000 - - oto94589
orthoMCL 1 0.900 - - OOG6_103994
Panther 1 1.100 - - LDO PTHR12735
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1811
SonicParanoid 1 1.000 - - X4383
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.