DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33672 and zgc:112271

DIOPT Version :9

Sequence 1:NP_001027413.1 Gene:CG33672 / 3771915 FlyBaseID:FBgn0061360 Length:86 Species:Drosophila melanogaster
Sequence 2:NP_001230100.1 Gene:zgc:112271 / 553698 ZFINID:ZDB-GENE-050522-443 Length:86 Species:Danio rerio


Alignment Length:79 Identity:43/79 - (54%)
Similarity:55/79 - (69%) Gaps:1/79 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LEEKLKRELQTEYVSVTDESDG-CGGKFSAVIVSPAFSGKTLLQKHRLVNSTLAEELKEIHAFSQ 72
            :.:||..|:...:|.|.|.|.. |...|..::|||.|.||.|||:||:||:.||:||||||||.|
Zfish     8 IRKKLIAEIGAIHVDVEDTSPSRCAASFKVLVVSPQFEGKQLLQRHRMVNNCLAQELKEIHAFEQ 72

  Fly    73 KSYTPEEWEKVKAQ 86
            |:.|||:|||.|||
Zfish    73 KTLTPEQWEKQKAQ 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33672NP_001027413.1 BolA 13..79 CDD:396332 35/66 (53%)
zgc:112271NP_001230100.1 BolA 12..79 CDD:279982 35/66 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595622
Domainoid 1 1.000 72 1.000 Domainoid score I9306
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I5120
OMA 1 1.010 - - QHG52896
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000905
OrthoInspector 1 1.000 - - oto39770
orthoMCL 1 0.900 - - OOG6_103994
Panther 1 1.100 - - LDO PTHR12735
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1811
SonicParanoid 1 1.000 - - X4383
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.930

Return to query results.
Submit another query.