DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33672 and BOLA1

DIOPT Version :9

Sequence 1:NP_001027413.1 Gene:CG33672 / 3771915 FlyBaseID:FBgn0061360 Length:86 Species:Drosophila melanogaster
Sequence 2:NP_001307954.1 Gene:BOLA1 / 51027 HGNCID:24263 Length:137 Species:Homo sapiens


Alignment Length:81 Identity:29/81 - (35%)
Similarity:46/81 - (56%) Gaps:7/81 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LEEKLKRELQTEYVSVTDESDG----CGGK--FSAVIVSPAFSGKTLLQKHRLVNSTLAEEL-KE 66
            :..||:..|..|.:.:.:||.|    .|.:  |...:||..|.|.:.||:||||::.||||| ..
Human    36 IRTKLEEALSPEVLELRNESGGHAVPPGSETHFRVAVVSSRFEGLSPLQRHRLVHAALAEELGGP 100

  Fly    67 IHAFSQKSYTPEEWEK 82
            :||.:.::.||.:|.:
Human   101 VHALAIQARTPAQWRE 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33672NP_001027413.1 BolA 13..79 CDD:396332 27/72 (38%)
BOLA1NP_001307954.1 BolA 40..113 CDD:307715 27/72 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..137 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0271
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000905
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1811
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.