powered by:
Protein Alignment CG33672 and bola3
DIOPT Version :9
Sequence 1: | NP_001027413.1 |
Gene: | CG33672 / 3771915 |
FlyBaseID: | FBgn0061360 |
Length: | 86 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001003525.1 |
Gene: | bola3 / 445131 |
ZFINID: | ZDB-GENE-040801-32 |
Length: | 104 |
Species: | Danio rerio |
Alignment Length: | 63 |
Identity: | 24/63 - (38%) |
Similarity: | 35/63 - (55%) |
Gaps: | 3/63 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 SKYLEEKLKRELQTEYVSVTDESDGCGGKFSAVIVSPAFSGKTLLQKHRLVNSTLAEELKEIH 68
::.|:||.. |...:.|.|.|.|||..:...|.|..|.||..:|:|:|||..|.:|:|.:|
Zfish 34 AQVLKEKFP---QATALKVVDISGGCGAMYEIHIESDEFKGKRTVQQHQLVNQALKDEIKAMH 93
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG33672 | NP_001027413.1 |
BolA |
13..79 |
CDD:396332 |
21/56 (38%) |
bola3 | NP_001003525.1 |
BolA |
32..102 |
CDD:294273 |
24/63 (38%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R1811 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.940 |
|
Return to query results.
Submit another query.