DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33672 and fra2

DIOPT Version :10

Sequence 1:NP_001027413.1 Gene:CG33672 / 3771915 FlyBaseID:FBgn0061360 Length:86 Species:Drosophila melanogaster
Sequence 2:NP_594282.2 Gene:fra2 / 2542160 PomBaseID:SPAC8C9.11 Length:84 Species:Schizosaccharomyces pombe


Alignment Length:82 Identity:36/82 - (43%)
Similarity:56/82 - (68%) Gaps:0/82 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DSKYLEEKLKRELQTEYVSVTDESDGCGGKFSAVIVSPAFSGKTLLQKHRLVNSTLAEELKEIHA 69
            :::.||..::..|:..::.:.|.|.|||..|..:||||.|.||:.|.:|||||..|.|.:|:|||
pombe     3 NAQQLELLIQNTLEPTHIEIQDMSGGCGQNFEVIIVSPLFEGKSTLARHRLVNHKLQEVIKDIHA 67

  Fly    70 FSQKSYTPEEWEKVKAQ 86
            |:||.|:|.:||.::|:
pombe    68 FTQKCYSPAQWEALQAK 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33672NP_001027413.1 BolA 1..82 CDD:440041 34/76 (45%)
fra2NP_594282.2 BolA 11..77 CDD:460305 31/65 (48%)

Return to query results.
Submit another query.