DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33672 and SPAC8C9.11

DIOPT Version :9

Sequence 1:NP_001027413.1 Gene:CG33672 / 3771915 FlyBaseID:FBgn0061360 Length:86 Species:Drosophila melanogaster
Sequence 2:NP_594282.2 Gene:SPAC8C9.11 / 2542160 PomBaseID:SPAC8C9.11 Length:84 Species:Schizosaccharomyces pombe


Alignment Length:82 Identity:36/82 - (43%)
Similarity:56/82 - (68%) Gaps:0/82 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DSKYLEEKLKRELQTEYVSVTDESDGCGGKFSAVIVSPAFSGKTLLQKHRLVNSTLAEELKEIHA 69
            :::.||..::..|:..::.:.|.|.|||..|..:||||.|.||:.|.:|||||..|.|.:|:|||
pombe     3 NAQQLELLIQNTLEPTHIEIQDMSGGCGQNFEVIIVSPLFEGKSTLARHRLVNHKLQEVIKDIHA 67

  Fly    70 FSQKSYTPEEWEKVKAQ 86
            |:||.|:|.:||.::|:
pombe    68 FTQKCYSPAQWEALQAK 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33672NP_001027413.1 BolA 13..79 CDD:396332 31/65 (48%)
SPAC8C9.11NP_594282.2 BolA 1..81 CDD:223349 35/77 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 72 1.000 Domainoid score I2592
eggNOG 1 0.900 - - E1_COG0271
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I1818
OMA 1 1.010 - - QHG52896
OrthoFinder 1 1.000 - - FOG0000905
OrthoInspector 1 1.000 - - oto101783
orthoMCL 1 0.900 - - OOG6_103994
Panther 1 1.100 - - LDO PTHR12735
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1811
SonicParanoid 1 1.000 - - X4383
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.