DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33672 and uvi31

DIOPT Version :9

Sequence 1:NP_001027413.1 Gene:CG33672 / 3771915 FlyBaseID:FBgn0061360 Length:86 Species:Drosophila melanogaster
Sequence 2:NP_595788.1 Gene:uvi31 / 2539858 PomBaseID:SPBC16E9.06c Length:102 Species:Schizosaccharomyces pombe


Alignment Length:97 Identity:32/97 - (32%)
Similarity:42/97 - (43%) Gaps:23/97 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKYDSKY--LEEKLKRELQTEY--------------VSVTDESDGCGGKFSAVIVSPAFSGKTL 49
            |.:.|..|  |.|.||.:..|.|              |..|:|:     .|...||||.|||.:.
pombe     9 MGRQDRIYKTLSEALKTDKITLYNDSYKHSHHIAMKGVPDTNET-----HFRLEIVSPEFSGMSR 68

  Fly    50 LQKHRLVNSTLAEELK-EIHAFS-QKSYTPEE 79
            :.:||||...|.:|.. .:||.. ..|.||:|
pombe    69 VARHRLVYGLLKDEFDGGLHALQITSSKTPDE 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33672NP_001027413.1 BolA 13..79 CDD:396332 26/81 (32%)
uvi31NP_595788.1 BolA 19..100 CDD:279982 28/85 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0271
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000905
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1811
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.