DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33672 and T12D8.10

DIOPT Version :9

Sequence 1:NP_001027413.1 Gene:CG33672 / 3771915 FlyBaseID:FBgn0061360 Length:86 Species:Drosophila melanogaster
Sequence 2:NP_001022757.1 Gene:T12D8.10 / 176801 WormBaseID:WBGene00023450 Length:98 Species:Caenorhabditis elegans


Alignment Length:75 Identity:33/75 - (44%)
Similarity:45/75 - (60%) Gaps:1/75 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LKRELQTEYVSVTDESDGCGG-KFSAVIVSPAFSGKTLLQKHRLVNSTLAEELKEIHAFSQKSYT 76
            |...::.:.:.|.|||.||.| ||..:|||.||.||..||.||||.:.||..:.|.||.:..:||
 Worm    12 LTEAIKPQILKVVDESGGCDGYKFRLLIVSEAFEGKCTLQSHRLVQAALAPIMDETHALTICAYT 76

  Fly    77 PEEWEKVKAQ 86
            ||.|.::..:
 Worm    77 PERWSQMTTE 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33672NP_001027413.1 BolA 13..79 CDD:396332 31/66 (47%)
T12D8.10NP_001022757.1 BolA 12..78 CDD:279982 30/65 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 60 1.000 Domainoid score I7017
eggNOG 1 0.900 - - E1_COG0271
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I3950
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52896
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000905
OrthoInspector 1 1.000 - - oto18002
orthoMCL 1 0.900 - - OOG6_103994
Panther 1 1.100 - - LDO PTHR12735
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1811
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.