DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33672 and Y105E8A.11

DIOPT Version :9

Sequence 1:NP_001027413.1 Gene:CG33672 / 3771915 FlyBaseID:FBgn0061360 Length:86 Species:Drosophila melanogaster
Sequence 2:NP_740939.1 Gene:Y105E8A.11 / 173306 WormBaseID:WBGene00013671 Length:106 Species:Caenorhabditis elegans


Alignment Length:77 Identity:27/77 - (35%)
Similarity:43/77 - (55%) Gaps:7/77 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DSKYLEEKLK-RELQTE------YVSVTDESDGCGGKFSAVIVSPAFSGKTLLQKHRLVNSTLAE 62
            :.|..|.:|| .:|.||      .|.|.|.|:|||..|..|:.:..|.||:.:.:|:.|.|.|.|
 Worm    27 EHKMSEAELKMSKLLTEGIDGCTRVEVHDVSNGCGSMFDVVVEAAGFKGKSKVAQHKQVTSILRE 91

  Fly    63 ELKEIHAFSQKS 74
            ::|::|..:.|:
 Worm    92 QIKDMHGLTIKT 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33672NP_001027413.1 BolA 13..79 CDD:396332 25/69 (36%)
Y105E8A.11NP_740939.1 BolA 30..105 CDD:294273 26/74 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0271
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1811
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.