DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33796 and CG14518

DIOPT Version :9

Sequence 1:NP_001027128.1 Gene:CG33796 / 3771914 FlyBaseID:FBgn0053796 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_651653.2 Gene:CG14518 / 43421 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster


Alignment Length:176 Identity:74/176 - (42%)
Similarity:116/176 - (65%) Gaps:2/176 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LKIVVSLTILCLMILKP--SNPVVFKLTNVHCGSYNKTWIRINQCRLKAINRHRTVFNFNATFLY 67
            :|||:.:.:|...:..|  .:.|:||:||..|.:|||:|:....|||:|::|::...|.:|..|:
  Fly     1 MKIVLVIWMLAHSLQPPYQCDAVIFKMTNAVCETYNKSWVEFGLCRLRAVSRNKVCLNVDANLLH 65

  Fly    68 PTKSITVHYQTFKRENGYRPWLVNTQIDGCRFLRKPYDALGILLFNIYRNFTNINHTCPLQGDMI 132
            |...:.|..:..||.|||:|||.:...|||:|:|:..:||..:::.:::.::.||||||..|...
  Fly    66 PVHDVIVKARLLKRANGYKPWLYSVSFDGCQFIRRRNNALIRIVWELFKEYSTINHTCPYVGLQQ 130

  Fly   133 VRNMYLTTDVMRLPLPTGDYLLAIDWIFYGKPQFATNVSFQFVEDI 178
            |:|.||.::.:..|:|||:|||.|||:|..|||.||||.|.||||:
  Fly   131 VKNFYLRSEKLPTPIPTGEYLLMIDWVFNKKPQAATNVYFTFVEDL 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33796NP_001027128.1 DUF1091 74..154 CDD:284008 32/79 (41%)
CG14518NP_651653.2 DM8 83..173 CDD:214778 41/89 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471913
Domainoid 1 1.000 43 1.000 Domainoid score I19524
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.