DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33796 and CG14456

DIOPT Version :9

Sequence 1:NP_001027128.1 Gene:CG33796 / 3771914 FlyBaseID:FBgn0053796 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001137998.1 Gene:CG14456 / 40481 FlyBaseID:FBgn0037176 Length:213 Species:Drosophila melanogaster


Alignment Length:134 Identity:31/134 - (23%)
Similarity:48/134 - (35%) Gaps:36/134 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 HRTVF-------NFNATFLYPTKSITVHYQ---TFKRENGYRPWLVNTQIDGCRFL----RKPYD 105
            |:.|:       ||:.........:.:|.:   |.|::..|...| ||.::.||.|    :.|  
  Fly    43 HKVVYDNSDPHLNFSMEVHQELHDVDIHVEVRITNKQDPYYNTNL-NTTLNVCRILGFANKSP-- 104

  Fly   106 ALGILLFNIYRNFTNINHTCP----------------LQGDMIVRNMYLTTDVMRLPLPTGDYLL 154
             :|..:....|.|.||..|||                |||...:...:...|.....||..::  
  Fly   105 -VGRFVHGFIREFGNIVETCPIAKGRYHWHRIHLKRKLQGSYFINKFWWPEDPTTAMLPELEF-- 166

  Fly   155 AIDW 158
            .|.|
  Fly   167 EIIW 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33796NP_001027128.1 DUF1091 74..154 CDD:284008 25/102 (25%)
CG14456NP_001137998.1 DM8 82..189 CDD:214778 24/95 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448159
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.