DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33796 and CG13250

DIOPT Version :9

Sequence 1:NP_001027128.1 Gene:CG33796 / 3771914 FlyBaseID:FBgn0053796 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_649245.1 Gene:CG13250 / 40284 FlyBaseID:FBgn0037013 Length:192 Species:Drosophila melanogaster


Alignment Length:136 Identity:29/136 - (21%)
Similarity:56/136 - (41%) Gaps:26/136 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LTILCLMILKPSNPVVF-----------KLTNVHCGSYNKTWIRINQCRLKAINRHRTVFNFNAT 64
            |.|||.:::    |:::           :..:::|...:.|...|.:|.:  :...:...||..|
  Fly    10 LLILCCLVV----PILWQPSLATRDFDIRWRDINCSVIDPTTAEIFKCDI--VEMPKKQGNFLNT 68

  Fly    65 FLYPTKSITVHY------QTFKRENGYRPWLVNTQIDGCRFL--RKPYDALGILLFNIYRNFTNI 121
            ||...:|:|..:      |...|::.....|...::|||..:  |.....|..:|..:.:: .|.
  Fly    69 FLLLRRSVTKMWVELSVGQIANRKDRPVQQLFKIRVDGCHLIEFRSKSRILNAVLHKLLQS-GNY 132

  Fly   122 NHTCPL 127
            ...|||
  Fly   133 PDACPL 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33796NP_001027128.1 DUF1091 74..154 CDD:284008 13/62 (21%)
CG13250NP_649245.1 DM8 95..181 CDD:214778 11/45 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472635
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.