DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33796 and CG13561

DIOPT Version :9

Sequence 1:NP_001027128.1 Gene:CG33796 / 3771914 FlyBaseID:FBgn0053796 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster


Alignment Length:177 Identity:50/177 - (28%)
Similarity:86/177 - (48%) Gaps:11/177 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VVSLTILCLM-----ILKPSNPVVFKLTNVHCGSYNKTWIRINQCRLKAINRHRTVFNFNATFL- 66
            :.:||.|.|:     ||:...  |.|.||:.|.|.::.:..::.|||.|:.|.....:..|..| 
  Fly     1 MATLTELFLLFGLWHILQVQG--VAKFTNIECLSADENFTTVSLCRLYAVKRDVVEMSLRANILR 63

  Fly    67 YPTKSITVHYQTFKRENGYRPWLVN-TQIDGCRFLRKPYDALGILLFNIYRNFTNINHTCPLQGD 130
            :|...:::..|..|:.:||:|:|.| .|.|.|.:|.|.......::.:.:.|.||:| .||:..:
  Fly    64 WPKGPVSMRMQLLKKASGYKPFLYNICQSDVCEYLEKRNHPFINIILSSFGNRTNVN-KCPIPPE 127

  Fly   131 MIVRNMYLTTDVM-RLPLPTGDYLLAIDWIFYGKPQFATNVSFQFVE 176
            :::.:......|: .:|||.|||.|...:.|:........|.|...|
  Fly   128 IVLEHFRFPVKVLDMMPLPFGDYGLFTTFTFHRSELAQVKVYFTLTE 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33796NP_001027128.1 DUF1091 74..154 CDD:284008 25/81 (31%)
CG13561NP_611830.3 DM8 82..173 CDD:214778 26/91 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471945
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.