DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33796 and CG33795

DIOPT Version :10

Sequence 1:NP_001027128.1 Gene:CG33796 / 3771914 FlyBaseID:FBgn0053796 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster


Alignment Length:179 Identity:95/179 - (53%)
Similarity:131/179 - (73%) Gaps:1/179 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKYVLKIVVSLTILCLMILKPSNPVVFKLTNVHCGSYNKTWIRINQCRLKAINRHRTVFNFNATF 65
            |..||||||.| :..|:..:.|..|.:|||||.|.|.|::|:.||:|||||:||:|||||||||.
  Fly     1 MSNVLKIVVIL-VTFLLTWRLSYSVTYKLTNVICESRNQSWVTINECRLKAVNRNRTVFNFNATI 64

  Fly    66 LYPTKSITVHYQTFKRENGYRPWLVNTQIDGCRFLRKPYDALGILLFNIYRNFTNINHTCPLQGD 130
            .:||..:.:.|:..||||||:|||....||||||||||||.|..:::.:::.|:|||||||..||
  Fly    65 HHPTNDVVIDYRFLKRENGYKPWLYKKNIDGCRFLRKPYDMLTKMIYMVFKPFSNINHTCPFYGD 129

  Fly   131 MIVRNMYLTTDVMRLPLPTGDYLLAIDWIFYGKPQFATNVSFQFVEDIL 179
            :::|.|||.|::..:|.|:|.|:|.|:|.||.|.|..||:|:.|:|::|
  Fly   130 ILIRGMYLRTEIKAMPYPSGKYMLQINWSFYKKIQVVTNISYDFIENLL 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33796NP_001027128.1 DUF1091 74..154 CDD:461928 42/79 (53%)
CG33795NP_001027129.2 DUF1091 77..153 CDD:461928 41/75 (55%)

Return to query results.
Submit another query.