DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33796 and CG33644

DIOPT Version :9

Sequence 1:NP_001027128.1 Gene:CG33796 / 3771914 FlyBaseID:FBgn0053796 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001027259.1 Gene:CG33644 / 3772563 FlyBaseID:FBgn0053644 Length:158 Species:Drosophila melanogaster


Alignment Length:165 Identity:32/165 - (19%)
Similarity:60/165 - (36%) Gaps:41/165 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LTNVHCGSYNKTWIRINQCRLKAINRHRTVFNFNATFLYPTKSITVHYQTFKRENGYR------- 86
            :|.:.|..::..:::...|||     |:...|..      :||.:..:...|..|..|       
  Fly     5 MTQIECPIHSPEYVQNFSCRL-----HKKSPNSG------SKSFSAEFSLRKEVNDVRGAYVFSF 58

  Fly    87 ---PWLVN---TQIDGCRFLRKPYDAL-GILLFNI----YRNFTNINHTCPLQGDMIVRNMY--- 137
               ..::|   .:||.|:.|    .|| ..:||.:    .|..:|....||    .::...|   
  Fly    59 KQGKSIINYTAMEIDYCQAL----SALQSQILFKLIADELRRVSNFPLNCP----FVMNKRYYVD 115

  Fly   138 -LTTDVMRLPLPTGDYLLAIDWIFYGKPQFATNVS 171
             .|.:...:|..|.:.:...|...:.|.:.|..::
  Fly   116 EFTINPKVIPSYTPEMIFTSDCNIFIKKRRAMQLT 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33796NP_001027128.1 DUF1091 74..154 CDD:284008 20/101 (20%)
CG33644NP_001027259.1 DUF1091 50..133 CDD:284008 18/90 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.