DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33796 and CG33658

DIOPT Version :9

Sequence 1:NP_001027128.1 Gene:CG33796 / 3771914 FlyBaseID:FBgn0053796 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001027209.1 Gene:CG33658 / 3772524 FlyBaseID:FBgn0053658 Length:181 Species:Drosophila melanogaster


Alignment Length:152 Identity:47/152 - (30%)
Similarity:77/152 - (50%) Gaps:9/152 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KLTNVHCGSYNKTWIRINQCRLKAINRHRTVFNFNATFLYPTKSITVHYQTFKRENGYRPWLVNT 92
            :.||..|.|..|....|..|.||::||.....:.....|....|:.|::...::.|||:|:|.|.
  Fly    29 EFTNFKCTSMAKDVADIEYCFLKSVNRTYQYLSTRIKVLKLLNSLKVNFGLHQQINGYKPFLYNI 93

  Fly    93 QIDGCRFLRK-PYDALGILLFNIYRNFTNINHTCPLQGDMIVRNMYLTTDVMR------LPLPTG 150
            .||||:|::. ..:.:....::..||.:|:||:||...|:|:..  ||::.:.      ||.|||
  Fly    94 TIDGCQFMKNTKSNVVAKYFYDFIRNISNLNHSCPYNHDIIMEK--LTSETINSRLPKTLPFPTG 156

  Fly   151 DYLLAIDWIFYGKPQFATNVSF 172
            :|:....||...|.:..|.:.|
  Fly   157 NYMFQTYWIANEKYRVVTKIYF 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33796NP_001027128.1 DUF1091 74..154 CDD:284008 29/86 (34%)
CG33658NP_001027209.1 DUF1091 84..160 CDD:284008 28/77 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472457
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.