DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33796 and CG33630

DIOPT Version :10

Sequence 1:NP_001027128.1 Gene:CG33796 / 3771914 FlyBaseID:FBgn0053796 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001027166.1 Gene:CG33630 / 3772504 FlyBaseID:FBgn0053630 Length:212 Species:Drosophila melanogaster


Alignment Length:50 Identity:14/50 - (28%)
Similarity:25/50 - (50%) Gaps:5/50 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 ILLFNIYR----NFTNINHTCPLQGDMIVRNMYLTTDVMRLPLPTGDYLL 154
            :.||.:.|    .|.:..:|.|:...|..:|:.| .|::..|:..|:|.|
  Fly    97 VQLFELRRINFCEFLSEYNTNPMMEMMFKKNVKL-NDIIVCPVRVGNYSL 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33796NP_001027128.1 DUF1091 74..154 CDD:461928 13/48 (27%)
CG33630NP_001027166.1 DM8 96..186 CDD:214778 13/49 (27%)

Return to query results.
Submit another query.