DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33796 and CG33912

DIOPT Version :10

Sequence 1:NP_001027128.1 Gene:CG33796 / 3771914 FlyBaseID:FBgn0053796 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001027139.1 Gene:CG33912 / 3772438 FlyBaseID:FBgn0053912 Length:165 Species:Drosophila melanogaster


Alignment Length:139 Identity:40/139 - (28%)
Similarity:63/139 - (45%) Gaps:19/139 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KLTNVHCGSYNKTWIRINQCRLKAINRHRTVFNFNATFL-YPTKSITVHYQTFKRENGYRPWLVN 91
            :..||.|.|.:|.:..|..|.||::||.....:.....| .|...:.:.:..:||..||:|:|.|
  Fly    27 EFANVQCESLDKDFALIEYCYLKSVNRSYKYVSIKVNLLKLPISKVKIRFGLYKRFTGYKPFLYN 91

  Fly    92 TQIDGCRFLRKPYDALGILLFNIYRNFTNINHTCPLQGDMIVRNM-YLTTD---VMRLPLPTGDY 152
            ..:|.|:||:.|......|.|.|:              |:::..| |.:.:   ...||.|.|.|
  Fly    92 ATLDACKFLKSPNSNPVALFFIIH--------------DIVLDKMSYHSVNNKLTKILPFPEGHY 142

  Fly   153 LLAIDWIFY 161
            ::.|.||.|
  Fly   143 MIEIHWIAY 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33796NP_001027128.1 DUF1091 74..154 CDD:461928 23/83 (28%)
CG33912NP_001027139.1 DUF1091 74..>145 CDD:461928 23/84 (27%)

Return to query results.
Submit another query.