DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33796 and CG33773

DIOPT Version :9

Sequence 1:NP_001027128.1 Gene:CG33796 / 3771914 FlyBaseID:FBgn0053796 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001027213.1 Gene:CG33773 / 3772436 FlyBaseID:FBgn0053773 Length:179 Species:Drosophila melanogaster


Alignment Length:158 Identity:46/158 - (29%)
Similarity:84/158 - (53%) Gaps:15/158 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LKIVVSLTILCLMILKPSNPVVFKLTNVHCGSYNKTWIRINQCRLKAINR-HRTVFNFNATFLYP 68
            :.:::::.|...:|...|.   |:.||::|.:::........|.||:||| ::.|.........|
  Fly     6 INLILAILIFYSIIKTNSR---FEFTNLNCTAFDLRVGEFENCNLKSINRSYKYVSGKYKLNQIP 67

  Fly    69 TKSITVHYQTFKRENGYRPWLVNTQIDGCRFLRKPYDALGIL--LFNIYRNFTNINHTCPLQGDM 131
            ...:.|::..:||.|||||:|.|...|.|:|:..| .:..:|  :|:.:..::|:||:||...|:
  Fly    68 LPRMKVNFIMWKRLNGYRPFLYNITADACKFVENP-KSNPVLKYIFDSFSAYSNMNHSCPYTSDL 131

  Fly   132 IVRNMYL------TTDVMRLPLPTGDYL 153
            ||..:.:      .|::  ||.|.|:||
  Fly   132 IVERLPIGFMNLRVTEI--LPFPEGNYL 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33796NP_001027128.1 DUF1091 74..154 CDD:284008 31/88 (35%)
CG33773NP_001027213.1 DUF1091 73..158 CDD:284008 31/88 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472444
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
54.940

Return to query results.
Submit another query.