DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33796 and CG33758

DIOPT Version :10

Sequence 1:NP_001027128.1 Gene:CG33796 / 3771914 FlyBaseID:FBgn0053796 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001027397.1 Gene:CG33758 / 3772381 FlyBaseID:FBgn0053758 Length:178 Species:Drosophila melanogaster


Alignment Length:176 Identity:46/176 - (26%)
Similarity:84/176 - (47%) Gaps:13/176 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VVSLTILCLMILKPSNPVVFKLTNVHCGSYNKTWIRINQCRLKAINRHRTVFNFNATFLYPTKSI 72
            :::|....|::| .|..|..|..::||.::::.:.....|:||||:|.|...:.......|...|
  Fly     1 MLALLFFTLLVL-TSTEVEAKFKSLHCAAFDQDFGEFLLCKLKAISRLRNSISVQYKLKQPVSKI 64

  Fly    73 TVHYQTFKRENGYRPWLVNTQIDGCRFLRKPYDALGILLFNIYRNFTNINHTCPLQGDMIVRNMY 137
            .:..:.|||.||:||:|.|...:.|.||.:..:.:..:.:...|.:...|::||.:   ::.|..
  Fly    65 FIRLEFFKRANGWRPFLYNFTANLCDFLARNNNVIMGIGYAYLRPYLVKNYSCPFK---VIENEL 126

  Fly   138 L-----TTDV----MRLPLPTGDYLLAIDWIFYGKPQFATNVSFQF 174
            |     ..|:    .|.|:.||:|.|.:.:|...|.....|.|.::
  Fly   127 LECKDFELDINNLRNRFPIETGEYALQLTFIAKNKAALTINGSIEY 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33796NP_001027128.1 DUF1091 74..154 CDD:461928 24/88 (27%)
CG33758NP_001027397.1 DUF1091 66..152 CDD:461928 24/88 (27%)

Return to query results.
Submit another query.