DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33796 and CG33758

DIOPT Version :9

Sequence 1:NP_001027128.1 Gene:CG33796 / 3771914 FlyBaseID:FBgn0053796 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001027397.1 Gene:CG33758 / 3772381 FlyBaseID:FBgn0053758 Length:178 Species:Drosophila melanogaster


Alignment Length:176 Identity:46/176 - (26%)
Similarity:84/176 - (47%) Gaps:13/176 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VVSLTILCLMILKPSNPVVFKLTNVHCGSYNKTWIRINQCRLKAINRHRTVFNFNATFLYPTKSI 72
            :::|....|::| .|..|..|..::||.::::.:.....|:||||:|.|...:.......|...|
  Fly     1 MLALLFFTLLVL-TSTEVEAKFKSLHCAAFDQDFGEFLLCKLKAISRLRNSISVQYKLKQPVSKI 64

  Fly    73 TVHYQTFKRENGYRPWLVNTQIDGCRFLRKPYDALGILLFNIYRNFTNINHTCPLQGDMIVRNMY 137
            .:..:.|||.||:||:|.|...:.|.||.:..:.:..:.:...|.:...|::||.:   ::.|..
  Fly    65 FIRLEFFKRANGWRPFLYNFTANLCDFLARNNNVIMGIGYAYLRPYLVKNYSCPFK---VIENEL 126

  Fly   138 L-----TTDV----MRLPLPTGDYLLAIDWIFYGKPQFATNVSFQF 174
            |     ..|:    .|.|:.||:|.|.:.:|...|.....|.|.::
  Fly   127 LECKDFELDINNLRNRFPIETGEYALQLTFIAKNKAALTINGSIEY 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33796NP_001027128.1 DUF1091 74..154 CDD:284008 24/88 (27%)
CG33758NP_001027397.1 DUF1091 66..152 CDD:284008 24/88 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 43 1.000 Domainoid score I19524
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.