DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33796 and CG33764

DIOPT Version :9

Sequence 1:NP_001027128.1 Gene:CG33796 / 3771914 FlyBaseID:FBgn0053796 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001027107.1 Gene:CG33764 / 3772289 FlyBaseID:FBgn0053764 Length:180 Species:Drosophila melanogaster


Alignment Length:160 Identity:51/160 - (31%)
Similarity:83/160 - (51%) Gaps:8/160 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VVSLTILCLMILKPSNPVVFKLTNVHCGSYNKTWIRINQCRLKAINRHRTVFNFNATFL-YPTKS 71
            |.||.:|...|.:..:  |.|.||:.|.|.::.:...:...||::||.....:.....| .|...
  Fly     9 VASLILLTYYITEIYS--VVKFTNIQCQSLDRDFALFDSWFLKSVNRSYKYVSVKVKLLKIPVSK 71

  Fly    72 ITVHYQTFKRENGYRPWLVNTQIDGCRFLRKPY-DALGILLFNIYRNFTNINHTCPLQGDMIVRN 135
            :.|.:..:||.|||.|:|.|...|.||||..|. :.:.:..:|.:::::||||:||...|:|:..
  Fly    72 VKVRFGLYKRVNGYMPFLYNMSFDACRFLTSPNPNPVALYFYNFFKDYSNINHSCPFDHDIILDK 136

  Fly   136 M---YLTTDVMR-LPLPTGDYLLAIDWIFY 161
            |   .:...|.: ||.|.|.|::.:.||.|
  Fly   137 MPYHSINNKVTKILPFPEGKYMIEMHWIAY 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33796NP_001027128.1 DUF1091 74..154 CDD:284008 31/84 (37%)
CG33764NP_001027107.1 DUF1091 74..159 CDD:284008 31/84 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472613
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.