DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33796 and CG33792

DIOPT Version :9

Sequence 1:NP_001027128.1 Gene:CG33796 / 3771914 FlyBaseID:FBgn0053796 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001027411.2 Gene:CG33792 / 3772111 FlyBaseID:FBgn0053792 Length:225 Species:Drosophila melanogaster


Alignment Length:210 Identity:52/210 - (24%)
Similarity:86/210 - (40%) Gaps:46/210 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IVVSLTILCLMILKP-----SNPVVFKLTNVHCGSYNKTWIRINQCRLKAINRHRTVFNFNATFL 66
            :.||...|.:::..|     ||...||:....|.: |..:.....|.||.:|..|:|.|.:....
  Fly     6 LAVSCVYLGVLLCLPNTIFYSNGYFFKIRKTECIA-NGAYFSNVSCILKPVNWTRSVLNMDGDIK 69

  Fly    67 YPTKSITVHYQTFKRE--NGYRPWLVNTQIDGCRFLRKPYDALGILLFNI--YRNFTNINHTCP- 126
            .....|.:..:.|.::  |.|:|:.|..:.|.|:.|:....:..:..:.|  ...:||:||:|| 
  Fly    70 EALTDIKMSVEVFYKDSSNLYKPFAVKFKFDVCQLLKNKTQSNFLQKYAISHLTEWTNVNHSCPY 134

  Fly   127 ----------------------LQGDMIVRNMYLTTDVMRLP-LPTGDYLLAIDW------IFYG 162
                                  |:|.:|.||..|  |.:.|| ||..||.:|.::      |..|
  Fly   135 RVSLCIYNIVKFSQYIEYIYMFLKGHLIARNFRL--DEVSLPILPIQDYKIAFNFSGANPGIHLG 197

  Fly   163 KPQFATNVSFQFVED 177
                ...:.|:.:||
  Fly   198 ----LVLIYFEILED 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33796NP_001027128.1 DUF1091 74..154 CDD:284008 28/107 (26%)
CG33792NP_001027411.2 DUF1091 82..183 CDD:284008 28/102 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.