DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33796 and CG33647

DIOPT Version :10

Sequence 1:NP_001027128.1 Gene:CG33796 / 3771914 FlyBaseID:FBgn0053796 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001027136.1 Gene:CG33647 / 3772049 FlyBaseID:FBgn0053647 Length:190 Species:Drosophila melanogaster


Alignment Length:144 Identity:35/144 - (24%)
Similarity:53/144 - (36%) Gaps:39/144 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LKIVVSLTILCLMILKP--SNPVVFKLTNVHCGSYNKTWIRINQCRLKAINRHRTVFNFNATFLY 67
            |.|:|.| ||..:||..  :...|| :|.:.|.:|....:|...|.|...:             :
  Fly     6 LFILVDL-ILGTLILSSVRAEKEVF-MTKIECLNYMPELVRNVSCYLNETS-------------H 55

  Fly    68 PTKSI--------------TVHYQTFKRENGYRPWLVNTQIDGCRFLRKPYDALGILLFNI---- 114
            ||.||              .::..|||| ..|.....::.:|.|:.|....:.   .||.:    
  Fly    56 PTGSIYAEFILTQDVEDLKGIYILTFKR-GSYVTNFTSSHVDYCQMLSSVENH---FLFRMVTTQ 116

  Fly   115 YRNFTNINHTCPLQ 128
            .|...|....|||:
  Fly   117 LRETANFPIQCPLK 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33796NP_001027128.1 DUF1091 74..154 CDD:461928 15/59 (25%)
CG33647NP_001027136.1 DUF1091 <95..156 CDD:461928 10/39 (26%)

Return to query results.
Submit another query.