DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33796 and CG33702

DIOPT Version :9

Sequence 1:NP_001027128.1 Gene:CG33796 / 3771914 FlyBaseID:FBgn0053796 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001027120.1 Gene:CG33702 / 3771932 FlyBaseID:FBgn0053702 Length:179 Species:Drosophila melanogaster


Alignment Length:184 Identity:51/184 - (27%)
Similarity:83/184 - (45%) Gaps:24/184 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKYVLKIVVSLTILCLMILKPSNPVVFKLTNVHCGSYNKTWIRINQCRLKAINRHRTVFNFNATF 65
            ||::....|.|||:   :...:....|:.||..|.|.:..:..:.:|.||.:.|.....||:...
  Fly     1 MKFLAITNVFLTII---LFSSTLGAHFRFTNFKCISLDPEFAVVKECILKMVRRSVVGINFHIAI 62

  Fly    66 LY--PTKSITVHYQTFKRENGYRPWLVNTQIDGCRFLRKPYDALGILLFNIYRNF-------TNI 121
            .|  |...|..:...|::.|.||.:|||..||.|.::|:|..      :.|:..|       ||.
  Fly    63 KYSQPINKIEFNLSIFRKSNMYRLFLVNHTIDFCYYMRRPEQ------YPIFYMFHDSLMAATNA 121

  Fly   122 NHTCP-LQGDMIVRNMYLT----TDVMRLPLPTGDYLLAIDWIFYGKPQFATNV 170
            ||:|| .:.|:.|:.|...    .|::.. ||.|:|.|.:....:|..:...|:
  Fly   122 NHSCPYTEKDIYVKKMTFNDKTLKDLLSF-LPVGEYKLVVSVGAFGVWRLQVNL 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33796NP_001027128.1 DUF1091 74..154 CDD:284008 28/91 (31%)
CG33702NP_001027120.1 DUF1091 73..158 CDD:284008 28/91 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472431
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
54.940

Return to query results.
Submit another query.