DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33796 and CG33752

DIOPT Version :9

Sequence 1:NP_001027128.1 Gene:CG33796 / 3771914 FlyBaseID:FBgn0053796 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001027409.1 Gene:CG33752 / 3771860 FlyBaseID:FBgn0053752 Length:185 Species:Drosophila melanogaster


Alignment Length:192 Identity:48/192 - (25%)
Similarity:96/192 - (50%) Gaps:25/192 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKYVLKIVVSLTILC--LMILKPSNPVVFKLTNVHCGSYNKTWIRINQCRLKAINRHRTVFNFNA 63
            |::::     :.:.|  .:.|:.:...:.:.|||.|...:|::.....|:|..:.|.....:...
  Fly     1 MRFII-----IRVFCTITLSLEINGESITRHTNVKCEVLDKSFAEFPVCKLNVLGRGIIAESVYM 60

  Fly    64 TFL-YPTKSITVHYQTFKRENGYRPWLVNTQIDGCRFLRKPYDALGIL--LFNIYRNFTNINHTC 125
            .|| .|.|.|:|::..:|:.:||.|:|.|..:|.|.:::.| :.:.|.  .:...:.::|.||:|
  Fly    61 KFLKLPIKKISVNFTVYKKLSGYHPFLFNVTVDFCHYMKHP-NPMNIFHYFYTAVKPYSNFNHSC 124

  Fly   126 PLQ-----GDMIVRNMYLTTDVM--RLPLPTGDYLLAID------WIFYGKPQFATNVSFQF 174
            |..     .|::|:: ::.||.|  ::|||||:|:.:|.      |.......|..||..::
  Fly   125 PYNVSESYHDILVKD-FVLTDTMFAKIPLPTGNYMFSIKLATDDVWRVVLNTYFDVNVENKY 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33796NP_001027128.1 DUF1091 74..154 CDD:284008 27/88 (31%)
CG33752NP_001027409.1 DUF1091 72..159 CDD:284008 27/88 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472522
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.