DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33796 and CG33927

DIOPT Version :9

Sequence 1:NP_001027128.1 Gene:CG33796 / 3771914 FlyBaseID:FBgn0053796 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001027147.1 Gene:CG33927 / 3771851 FlyBaseID:FBgn0053927 Length:182 Species:Drosophila melanogaster


Alignment Length:175 Identity:76/175 - (43%)
Similarity:108/175 - (61%) Gaps:4/175 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VLKIVVSLTILCLMILKPSNPVVFKLTNVHCGSYNKTWIRINQCRLKAINRHRTVFNFNATFLYP 68
            ||.:|:...|  .:.|...|...||.||..|.|.|:||:.::|||||||.|..|..:||.|.|..
  Fly     7 VLYLVLFFRI--ALELGSINASRFKFTNFVCDSVNETWLAVHQCRLKAIRRGTTTLSFNGTVLKT 69

  Fly    69 TKSITVHYQTFKRENGYRPWLVNTQIDGCRFLRKPYDALGILLFNIYRNFTNINHTCPLQGDMIV 133
            .....||.|.|||.||::|||.|...||||||||||:|..|::||:.::|:|:|.|||..|.:.:
  Fly    70 ISKFRVHGQIFKRANGFKPWLYNITFDGCRFLRKPYEAPVIIVFNLLKSFSNLNFTCPYMGPVHI 134

  Fly   134 RNMYLTTDVMRLPLPTGDYLLAIDWIFYGKPQF-ATNVSFQFVED 177
            ..:::..:.:.:|||||:||:.|.| :..|..| :|.:.|.|.|:
  Fly   135 MGLHIIGEQIPVPLPTGEYLIQIKW-YISKTLFLSTGIKFAFEEN 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33796NP_001027128.1 DUF1091 74..154 CDD:284008 39/79 (49%)
CG33927NP_001027147.1 DUF1091 75..155 CDD:284008 39/79 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471885
Domainoid 1 1.000 43 1.000 Domainoid score I19524
eggNOG 1 0.900 - - E1_2FAUQ
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
87.890

Return to query results.
Submit another query.