DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33796 and CG33703

DIOPT Version :10

Sequence 1:NP_001027128.1 Gene:CG33796 / 3771914 FlyBaseID:FBgn0053796 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001027119.1 Gene:CG33703 / 3771760 FlyBaseID:FBgn0053703 Length:181 Species:Drosophila melanogaster


Alignment Length:152 Identity:40/152 - (26%)
Similarity:73/152 - (48%) Gaps:8/152 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VVSLTILCLMILKPSNPVVFKLTNVHCGSYNKTWIRINQCRLKAINRHRTVFNFNATFLY--PTK 70
            ::||.:..|:||..|...||:::.:.|.|.:.::.....|::......|.....:..|||  |..
  Fly     5 LLSLVLPLLIILDCSQGRVFRVSKMECRSLDPSFTYFKTCKVVRRENGRAALYVSEVFLYKDPID 69

  Fly    71 SITVHYQTFKRENGYRPWLVNTQIDGCRFLRKPYDA---LGILLFNIYRNFTNINHTCPLQGDMI 132
            .|.::...|:.....|...:|..:|.|.|.|: |.|   .|.|:..:.| .:|:|.|||||.::.
  Fly    70 DIVLNLGVFRIAKNRRFQFLNETLDYCLFSRQ-YLASGFFGFLMTPLLR-ISNLNATCPLQQNIT 132

  Fly   133 VRNMYLTTDVMR-LPLPTGDYL 153
            .....:..:.:: :|:|.|.|:
  Fly   133 FNGFSVDENTIKEIPIPNGVYM 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33796NP_001027128.1 DUF1091 74..154 CDD:461928 23/84 (27%)
CG33703NP_001027119.1 DUF1091 73..155 CDD:461928 23/84 (27%)

Return to query results.
Submit another query.