DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33796 and CG33454

DIOPT Version :9

Sequence 1:NP_001027128.1 Gene:CG33796 / 3771914 FlyBaseID:FBgn0053796 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_995887.1 Gene:CG33454 / 2768850 FlyBaseID:FBgn0053454 Length:173 Species:Drosophila melanogaster


Alignment Length:172 Identity:64/172 - (37%)
Similarity:111/172 - (64%) Gaps:3/172 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IVVSLTILCLMILKPSNPVVFKLTNVHCGSYNKTWIRINQCRLKAINRHRTVFNFNATFLYPTKS 71
            :::....:.::.|..|:..:.|:|||.|.||:|:....:.|||||.:|.:|..:.|||||:|..|
  Fly     5 VIILGVFVAVVFLVYSDSAMVKMTNVVCESYDKSLTVFHYCRLKAYSRTKTSLHINATFLHPINS 69

  Fly    72 ITVHYQTFKRENGYRPWLVNTQIDGCRFLRKPYDALGILLFNIYRNFTNINHTCPLQGDMIVRNM 136
            |:|.:|..||.|||:|:|.:..:|.|:|||||.:.:..:::|:.::.:||||:|| .|.:::.:.
  Fly    70 ISVRFQMLKRANGYKPFLFDITVDACQFLRKPNNPVIKIVYNMIKDASNINHSCP-YGTVVLNDF 133

  Fly   137 YLTTDVMRLPLPTGDYLLAIDWIFYGKPQFATNVSFQFVEDI 178
            :..:  :.||.|:||||..:|::..||.:|..||:....||:
  Fly   134 HRIS--LPLPFPSGDYLSRLDFLINGKTKFYVNVNMHVPEDL 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33796NP_001027128.1 DUF1091 74..154 CDD:284008 30/79 (38%)
CG33454NP_995887.1 DUF1091 72..148 CDD:284008 29/78 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471900
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.