DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33645 and CG13561

DIOPT Version :9

Sequence 1:NP_001027260.3 Gene:CG33645 / 3771913 FlyBaseID:FBgn0053645 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster


Alignment Length:143 Identity:37/143 - (25%)
Similarity:54/143 - (37%) Gaps:38/143 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KEVNITHLDTDLYEKFE----CKVYQVDNRTYMDSVHIFKRTVDDITVHAALDFW---------- 79
            |..||..|..|  |.|.    |::|.|            ||.|.::::.|.:..|          
  Fly    24 KFTNIECLSAD--ENFTTVSLCRLYAV------------KRDVVEMSLRANILRWPKGPVSMRMQ 74

  Fly    80 --KLNSKQKMKLYDV-QFNGCYILENANKNRLFNMYVQNLKKHSNVKFKCPFRANVSYE-----V 136
              |..|..|..||:: |.:.|..||..| :...|:.:.:....:||. |||....:..|     |
  Fly    75 LLKKASGYKPFLYNICQSDVCEYLEKRN-HPFINIILSSFGNRTNVN-KCPIPPEIVLEHFRFPV 137

  Fly   137 KNLTMSEQDFPSF 149
            |.|.|....|..:
  Fly   138 KVLDMMPLPFGDY 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33645NP_001027260.3 DUF1091 80..156 CDD:310821 22/76 (29%)
CG13561NP_611830.3 DM8 82..173 CDD:214778 20/71 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.