DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33645 and CG33648

DIOPT Version :9

Sequence 1:NP_001027260.3 Gene:CG33645 / 3771913 FlyBaseID:FBgn0053645 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001027265.2 Gene:CG33648 / 3772188 FlyBaseID:FBgn0053648 Length:178 Species:Drosophila melanogaster


Alignment Length:153 Identity:36/153 - (23%)
Similarity:59/153 - (38%) Gaps:33/153 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FNSMRCEERNFRVYIKEVNITHLDTDLYEKFECKVYQVDNRTYMDSVHIFKR----TVDDITVHA 74
            |.:::|...              ||.......|::..| |||| ..:.:..|    .:.:.|::.
  Fly    25 FTNIKCSSS--------------DTSYVYYESCRIKSV-NRTY-KYISVNSRLLILPLTNATINV 73

  Fly    75 ALDFWKLNSKQKMKLYDVQFNGCYILENANKNRLFNMYVQNLKKHSNVKF-KCPFRANVSYEVKN 138
            ||  :|..:..|..||:|..:.|..|.....|.:.......:...||::. .|||.:.:|  |..
  Fly    74 AL--YKRYNGYKPFLYNVSVDACRFLRTQKSNIVVKYLFDLILLKSNIRSPTCPFNSFIS--VDK 134

  Fly   139 LTMS------EQDFPSFVPLGKF 155
            ||.:      .|..|  ||.|.:
  Fly   135 LTTNFLNNKLTQVLP--VPEGDY 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33645NP_001027260.3 DUF1091 80..156 CDD:310821 22/83 (27%)
CG33648NP_001027265.2 DUF1091 71..157 CDD:284008 24/91 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.