DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33645 and CG33647

DIOPT Version :9

Sequence 1:NP_001027260.3 Gene:CG33645 / 3771913 FlyBaseID:FBgn0053645 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001027136.1 Gene:CG33647 / 3772049 FlyBaseID:FBgn0053647 Length:190 Species:Drosophila melanogaster


Alignment Length:189 Identity:43/189 - (22%)
Similarity:77/189 - (40%) Gaps:25/189 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNFLLLF-----FSATLIFNSMRCEERNFRVYIKEVNITHLDTDLYEKFECKVYQVDNRTYMDSV 60
            ||...||     ...|||.:|:|.|:   .|::.::...:...:|.....|.:.:..:.|  .|:
  Fly     1 MNVKKLFILVDLILGTLILSSVRAEK---EVFMTKIECLNYMPELVRNVSCYLNETSHPT--GSI 60

  Fly    61 H---IFKRTVDDITVHAALDFWKLNSKQKMKLYDVQFNG-----CYILENANKNRLFNMYVQNLK 117
            :   |..:.|:|:.....|.|       |...|...|..     |.:|.:...:.||.|....|:
  Fly    61 YAEFILTQDVEDLKGIYILTF-------KRGSYVTNFTSSHVDYCQMLSSVENHFLFRMVTTQLR 118

  Fly   118 KHSNVKFKCPFRANVSYEVKNLTMSEQDFPSFVPLGKFRSLIEYCTNQKLRARVIASGQ 176
            :.:|...:||.:.|..|..|..|::.:..||::|...|.|........:...|::..|:
  Fly   119 ETANFPIQCPLKMNKRYYAKGFTVNSKFIPSYMPETNFISDAHLSVKDRKVFRLLIKGR 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33645NP_001027260.3 DUF1091 80..156 CDD:310821 19/80 (24%)
CG33647NP_001027136.1 DUF1091 <95..156 CDD:284008 16/60 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.