DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33645 and CG33475

DIOPT Version :9

Sequence 1:NP_001027260.3 Gene:CG33645 / 3771913 FlyBaseID:FBgn0053645 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_995799.1 Gene:CG33475 / 2768724 FlyBaseID:FBgn0053475 Length:147 Species:Drosophila melanogaster


Alignment Length:141 Identity:35/141 - (24%)
Similarity:58/141 - (41%) Gaps:46/141 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VNITHLDTDLYEKFECKVYQVDNRTYMDSVHIFKRTVDDITVHAALDFWKLNSKQKMKLYDVQFN 95
            :|.|.|..:::         :|||.   ...:..||:.:|...|..:|  ||::...|:|.|.:.
  Fly    32 INSTKLFKNIF---------LDNRI---QNAVSNRTIYNIKNLAICNF--LNNRLISKVYSVIYE 82

  Fly    96 GCYILENANKNRLFNMYVQNLKKHSNVKFKCPFRANVSYEVKNLTMSEQDF--PSFVPLGKFRSL 158
            |               :|.|     :..|:||.:.:|.|    |:.|.::|  |.|...|.||..
  Fly    83 G---------------FVGN-----STVFRCPVQPSVYY----LSNSVREFEVPIFHQPGMFRLY 123

  Fly   159 IEYCTNQKLRA 169
            :      ||:|
  Fly   124 V------KLKA 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33645NP_001027260.3 DUF1091 80..156 CDD:310821 19/77 (25%)
CG33475NP_995799.1 DUF1091 54..122 CDD:284008 25/93 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.