DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33645 and CG33475

DIOPT Version :10

Sequence 1:NP_001027260.3 Gene:CG33645 / 3771913 FlyBaseID:FBgn0053645 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_995799.1 Gene:CG33475 / 2768724 FlyBaseID:FBgn0053475 Length:147 Species:Drosophila melanogaster


Alignment Length:141 Identity:35/141 - (24%)
Similarity:58/141 - (41%) Gaps:46/141 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VNITHLDTDLYEKFECKVYQVDNRTYMDSVHIFKRTVDDITVHAALDFWKLNSKQKMKLYDVQFN 95
            :|.|.|..:::         :|||.   ...:..||:.:|...|..:|  ||::...|:|.|.:.
  Fly    32 INSTKLFKNIF---------LDNRI---QNAVSNRTIYNIKNLAICNF--LNNRLISKVYSVIYE 82

  Fly    96 GCYILENANKNRLFNMYVQNLKKHSNVKFKCPFRANVSYEVKNLTMSEQDF--PSFVPLGKFRSL 158
            |               :|.|     :..|:||.:.:|.|    |:.|.::|  |.|...|.||..
  Fly    83 G---------------FVGN-----STVFRCPVQPSVYY----LSNSVREFEVPIFHQPGMFRLY 123

  Fly   159 IEYCTNQKLRA 169
            :      ||:|
  Fly   124 V------KLKA 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33645NP_001027260.3 DUF1091 80..156 CDD:461928 19/77 (25%)
CG33475NP_995799.1 DUF1091 52..122 CDD:461928 25/95 (26%)

Return to query results.
Submit another query.