DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33849 and AT1G06760

DIOPT Version :9

Sequence 1:NP_001027359.1 Gene:His1:CG33849 / 3771912 FlyBaseID:FBgn0053849 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_172161.1 Gene:AT1G06760 / 837187 AraportID:AT1G06760 Length:274 Species:Arabidopsis thaliana


Alignment Length:262 Identity:99/262 - (37%)
Similarity:133/262 - (50%) Gaps:41/262 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSAVATSASPVAAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKERGG 65
            ::|:||  ...|.|....|...|.|::|.:.:|..|.:..|   |||..::|:..:|..||||.|
plant    22 VTDAAV--EKKPAAKGRKTKNVKEVKEKKTVAAAPKKRTVS---SHPTYEEMIKDAIVTLKERTG 81

  Fly    66 SSLLAIKKYITATYKCDAQKLAPFIKKY----LKSAVVNGKLIQTKGKGASGSFKLSASAKKEKD 126
            ||..||:|:|....|    :|.|..:|.    ||..|.:|||::.|     .||||.:::.|...
plant    82 SSQYAIQKFIEEKRK----ELPPTFRKLLLLNLKRLVASGKLVKVK-----ASFKLPSASAKASS 137

  Fly   127 PKAKSKVLSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVATK-KTAENKK-TEKAKAK 189
            |||     :|||...:||..: .:.|:..|..|.||.   ||||.:|.| |||..|| |.|||||
plant   138 PKA-----AAEKSAPAKKKPA-TVAVTKAKRKVAAAS---KAKKTIAVKPKTAAAKKVTAKAKAK 193

  Fly   190 DAKKTGIIKSKPAATKAKVTAAKPKAVVAKASKAKPAVSAKPKKTVKKASVSATAKKPKAKTTAA 254
            .     :.::..||||.|...|||||      ||:||.:||..|....|..:..|.| |..|.|.
plant   194 P-----VPRATAAATKRKAVDAKPKA------KARPAKAAKTAKVTSPAKKAVAATK-KVATVAT 246

  Fly   255 KK 256
            ||
plant   247 KK 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33849NP_001027359.1 Linker_histone 46..118 CDD:278939 29/75 (39%)
AT1G06760NP_172161.1 H15 60..124 CDD:197772 28/75 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 106 1.000 Inparanoid score I2109
OMA 1 1.010 - - QHG55300
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.