DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33849 and h1m

DIOPT Version :9

Sequence 1:NP_001027359.1 Gene:His1:CG33849 / 3771912 FlyBaseID:FBgn0053849 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_005174537.2 Gene:h1m / 327403 ZFINID:ZDB-GENE-030131-5614 Length:290 Species:Danio rerio


Alignment Length:264 Identity:83/264 - (31%)
Similarity:119/264 - (45%) Gaps:30/264 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SASPVAAPPATVEKKVVQKKAS---GSAGTKAKKASATPSHPPTQQMVDASIKNLKERGGSSLLA 70
            :|.|.|....:.|.:..:.|.:   .:|.:.|:|.|   .||.|.:||..::|.|..|.|.|..|
Zfish    41 AAEPTATITKSSENETTETKPAPEDSNAKSAARKVS---PHPSTMEMVKEALKELDSRKGVSAQA 102

  Fly    71 IKKYITATY-KCDAQKLAPFIKKYLKSAVVNGKLIQTKGK----GASGSFKLSASAKKEKDPKAK 130
            |:.||...| ..|..:|...:::.|...:..|..::....    ||.|.|:::|.. |.|:.||:
Zfish   103 IRGYIKEKYTTVDETRLKYMVRRALNKGMDTGVFVRPANSGSTTGAQGRFRIAAKT-KAKEAKAQ 166

  Fly   131 SKVLSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAV---ATKKTAENKKTEKAKAKDAK 192
            ||..:...:.::.|....|   ::|....||..:||..||..   |..||:|...| .:|...||
Zfish   167 SKENADPNEPKATKPKKAK---ATKAKGEGATKEKPTKKKETTDDAKPKTSEQNGT-ASKVAPAK 227

  Fly   193 KTGIIKSKPAATKAKVTAAKPKAVVAKASK---AKPAVSAKPKKTVKKA--SVSATAKKPKAKTT 252
            |.   |:|.||.:.   .||||...|||||   .:||.....||...||  ..|..|...||...
Zfish   228 KP---KAKNAAGEG---GAKPKPSKAKASKEGAEEPAAKKGGKKNAVKAEDGESGAAATEKAPGK 286

  Fly   253 AAKK 256
            .|||
Zfish   287 RAKK 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33849NP_001027359.1 Linker_histone 46..118 CDD:278939 23/76 (30%)
h1mXP_005174537.2 Linker_histone 78..154 CDD:306920 23/75 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.