DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33849 and H1-1

DIOPT Version :9

Sequence 1:NP_001027359.1 Gene:His1:CG33849 / 3771912 FlyBaseID:FBgn0053849 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_005316.1 Gene:H1-1 / 3024 HGNCID:4715 Length:215 Species:Homo sapiens


Alignment Length:229 Identity:86/229 - (37%)
Similarity:113/229 - (49%) Gaps:28/229 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PPATVEKKVVQKKASGSAGTKAKKASAT----PSHPPTQQMVDASIKNLKERGGSSLLAIKKYIT 76
            |||.......:|..:|....|..||:|.    |:.|...:::..:..:.|||||.||.|:||.:.
Human     6 PPAPAASAAPEKPLAGKKAKKPAKAAAASKKKPAGPSVSELIVQAASSSKERGGVSLAALKKALA 70

  Fly    77 AT-YKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDPKAKSKVLSAEKKV 140
            |. |  |.:|....||..:||.|..|.|:||||.||||||||:..|...:.....|||.:..|..
Human    71 AAGY--DVEKNNSRIKLGIKSLVSKGTLVQTKGTGASGSFKLNKKASSVETKPGASKVATKTKAT 133

  Fly   141 QSKKVASKKIGVSSKKTAVGAADKKP-KAKKAVATKKTAEN-KKTEKAKAKDAKKTGIIKSKPAA 203
            .:.|...|..|.|.|..      |.| ||||..||:|:::| ||.:..|.|          |.|.
Human   134 GASKKLKKATGASKKSV------KTPKKAKKPAATRKSSKNPKKPKTVKPK----------KVAK 182

  Fly   204 TKAKVTAAKPKAVVAKASKAKPAVSAKPKKTVKK 237
            :.||..|.||||..|:.:|.|   :|||||...|
Human   183 SPAKAKAVKPKAAKARVTKPK---TAKPKKAAPK 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33849NP_001027359.1 Linker_histone 46..118 CDD:278939 33/72 (46%)
H1-1NP_005316.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43 11/36 (31%)
Linker_histone 41..111 CDD:306920 33/71 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 94..215 56/139 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10654
eggNOG 1 0.900 - - E1_KOG4012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4734
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X117
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.