DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33849 and H1f10

DIOPT Version :9

Sequence 1:NP_001027359.1 Gene:His1:CG33849 / 3771912 FlyBaseID:FBgn0053849 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_941024.1 Gene:H1f10 / 243529 MGIID:2685307 Length:188 Species:Mus musculus


Alignment Length:253 Identity:66/253 - (26%)
Similarity:95/253 - (37%) Gaps:89/253 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 AAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQ----------------QMVDASIKNLKE 62
            |.||.:.:            ||..|.|.|..|..|||                |:|..:|:.|.|
Mouse     8 ALPPTSAD------------GTARKTAKAGGSAAPTQPKRRKNRKKNQPGKYSQLVVETIRKLGE 60

  Fly    63 RGGSSLLAIKKYITATYKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDP 127
            ||||||..|..........|.|....::|..:::.|.|..|:|.||.||:|||||:         
Mouse    61 RGGSSLARIYAEARKVAWFDQQNGRTYLKYSIRALVQNDTLLQVKGTGANGSFKLN--------- 116

  Fly   128 KAKSKVLSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVATKKTAENKKTEKAKAKDAK 192
                     .||::         |.:.::.|..|:...|||:.|.|.:                 
Mouse   117 ---------RKKLE---------GGAERRGASAASSPAPKARTAAADR----------------- 146

  Fly   193 KTGIIKSKPAATKAKVTAAKPKAVVAKASKAKPAVSAKPKKTVKKASVSATAKKPKAK 250
                            |.|:|:. ..:|.|:|.|.:|...|.||||:..:..|.||.:
Mouse   147 ----------------TPARPQP-ERRAHKSKKAAAAASAKKVKKAAKPSVPKVPKGR 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33849NP_001027359.1 Linker_histone 46..118 CDD:278939 30/87 (34%)
H1f10NP_941024.1 H15 46..119 CDD:238028 28/90 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.