DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33849 and hil-5

DIOPT Version :9

Sequence 1:NP_001027359.1 Gene:His1:CG33849 / 3771912 FlyBaseID:FBgn0053849 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_491678.1 Gene:hil-5 / 172242 WormBaseID:WBGene00001856 Length:225 Species:Caenorhabditis elegans


Alignment Length:262 Identity:99/262 - (37%)
Similarity:125/262 - (47%) Gaps:45/262 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSAVATSASPVAAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKERGG 65
            |||.|||.:       || |:......||:.:..||..|.....:|||...|:..::.|||:|.|
 Worm     1 MSDVAVAET-------PA-VKTPTKASKATKAKATKIPKVKVVAAHPPFINMITEAVSNLKDRKG 57

  Fly    66 SSLLAIKKYITATYKCDAQ--KLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDPK 128
            ||.:||.|:|||.|....|  |....::..||..||:..|:||.|.||:|.|:|:.:.|    |.
 Worm    58 SSRVAIFKFITAKYTLGDQVNKTNAHLRSALKKGVVSKVLVQTNGIGANGRFRLAVAEK----PP 118

  Fly   129 AKSKVLSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVATKKTAENKKTEKAKAKDAKK 193
            |..|..:.|:||. |.||.|.:          :.|   ||||.|| |||.:..|    |.|..|:
 Worm   119 AVKKAATGEQKVM-KTVAKKAV----------SGD---KAKKTVA-KKTGDKVK----KVKSPKR 164

  Fly   194 TGIIKSKPAATKAKVTAAKPKAVVAK--ASKAKPAVSAKPKK-TVKKASVSATAKKP--KAKTTA 253
            .    :|||..|....||.|....|.  |.|...|..|.||| .|.||   ||.|.|  ||..||
 Worm   165 I----AKPAVKKVTKKAAAPTKSAANETAPKKAAATEAAPKKAAVTKA---ATKKTPARKAVGTA 222

  Fly   254 AK 255
            .|
 Worm   223 PK 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33849NP_001027359.1 Linker_histone 46..118 CDD:278939 32/73 (44%)
hil-5NP_491678.1 Linker_histone 38..112 CDD:278939 32/73 (44%)
HC2 113..>225 CDD:284736 52/142 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 65 1.000 Domainoid score I6615
eggNOG 1 0.900 - - E1_KOG4012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I3461
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55300
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 1 1.000 - - mtm4774
orthoMCL 1 0.900 - - OOG6_110754
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.770

Return to query results.
Submit another query.