DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33849 and H1-8

DIOPT Version :9

Sequence 1:NP_001027359.1 Gene:His1:CG33849 / 3771912 FlyBaseID:FBgn0053849 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_722575.1 Gene:H1-8 / 132243 HGNCID:18463 Length:346 Species:Homo sapiens


Alignment Length:328 Identity:85/328 - (25%)
Similarity:128/328 - (39%) Gaps:75/328 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSAVATSASPVAAPPATVEKKVVQKKASGSAG---TKAKKASATP---SHPPTQQMVDASIKN 59
            |:..:|.:..||.:...|...:....:|...|.|   ......|:.|   .|||..:||..:::.
Human     1 MAPGSVTSDISPSSTSTAGSSRSPESEKPGPSHGGVPPGGPSHSSLPVGRRHPPVLRMVLEALQA 65

  Fly    60 LKERGGSSLLAIKKYITATY-KCDAQKLAPFIKKYLKSAVVNGKL---IQTKGKGASGSFKLSAS 120
            .::|.|:|:.|||.||...| ..|..:....:|:.|.:.:..|.|   :.:|.:||:|||||...
Human    66 GEQRRGTSVAAIKLYILHKYPTVDVLRFKYLLKQALATGMRRGLLARPLNSKARGATGSFKLVPK 130

  Fly   121 AKKEKDPKAKSKVLSAEKKVQSKKVASKK----------IGVSSKKTAVGAADKKPKAKKAVATK 175
            .||:..|:..:...:..:..::|....||          :|...|.....|..:||..|...||:
Human   131 HKKKIQPRKMAPATAPRRAGEAKGKGPKKPSEAKEDPPNVGKVKKAAKRPAKVQKPPPKPGAATE 195

  Fly   176 K--------------TAENKK------------------TEKAKAKDAK------------KTGI 196
            |              :.|.:|                  :.|||||.::            |...
Human   196 KARKQGGAAKDTRAQSGEARKVPPKPDKAMRAPSSAGGLSRKAKAKGSRSSQGDAEAYRKTKAES 260

  Fly   197 IKSKPAATKAKVTAAKP--KAVVAKASKAKP-----AVSAKPKK----TVKKASVSATAKKPKAK 250
            ..|||.|:|.|..||.|  |.|||||...|.     ..:|.|.|    .|..|.:|...:.||..
Human   261 KSSKPTASKVKNGAASPTKKKVVAKAKAPKAGQGPNTKAAAPAKGSGSKVVPAHLSRKTEAPKGP 325

  Fly   251 TTA 253
            ..|
Human   326 RKA 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33849NP_001027359.1 Linker_histone 46..118 CDD:278939 26/75 (35%)
H1-8NP_722575.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50 10/48 (21%)
H15 49..139 CDD:238028 30/89 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..346 54/208 (26%)
Nuclear localization signal. /evidence=ECO:0000255 164..179 2/14 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.