DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33834 and H1-10

DIOPT Version :9

Sequence 1:NP_001027334.1 Gene:His1:CG33834 / 3771911 FlyBaseID:FBgn0053834 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_006017.1 Gene:H1-10 / 8971 HGNCID:4722 Length:213 Species:Homo sapiens


Alignment Length:234 Identity:79/234 - (33%)
Similarity:101/234 - (43%) Gaps:46/234 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 AAPPATVE---KKVGQKKASGSAG---TKAKKASATPSHP-PTQQMGDASIKNLKERGGSSLLAI 71
            |.|..|.|   |||  .||.|||.   :|.:|.|...:.| ...|:...:|:.|.||.||||..|
Human     8 ALPVTTAEGMAKKV--TKAGGSAALSPSKKRKNSKKKNQPGKYSQLVVETIRRLGERNGSSLAKI 70

  Fly    72 KKYITATYKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDPKAKSKVLSA 136
            ..........|.|....::|..:|:.|.|..|:|.||.||:|||||:                  
Human    71 YTEAKKVPWFDQQNGRTYLKYSIKALVQNDTLLQVKGTGANGSFKLN------------------ 117

  Fly   137 EKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAV--------ATKKTAENKKTEKAKAKDAKK 193
            .||::.   ..::.|..:..||  .|....|||||.        |.||.|..:|.|:...|  |.
Human   118 RKKLEG---GGERRGAPAAATA--PAPTAHKAKKAAPGAAGSRRADKKPARGQKPEQRSHK--KG 175

  Fly   194 TGIIKSKPAATKAKVTAAKPKAVIAKASKAKPAVSAKPK 232
            .|..|.|  ..|||.|||.....:.||  |||:|...||
Human   176 AGAKKDK--GGKAKKTAAAGGKKVKKA--AKPSVPKVPK 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33834NP_001027334.1 Linker_histone 46..118 CDD:278939 27/72 (38%)
H1-10NP_006017.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..49 9/26 (35%)
H15 47..120 CDD:238028 27/90 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 107..213 44/133 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.