DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33834 and HHO1

DIOPT Version :9

Sequence 1:NP_001027334.1 Gene:His1:CG33834 / 3771911 FlyBaseID:FBgn0053834 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_015198.1 Gene:HHO1 / 855976 SGDID:S000006048 Length:258 Species:Saccharomyces cerevisiae


Alignment Length:261 Identity:67/261 - (25%)
Similarity:95/261 - (36%) Gaps:85/261 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSAVATSASPVAAPPATVEKKVGQKKASGSAG---TKAKKASATPSHPPTQQMGDASIKNLKE 62
            |:.....|..:.....|||.:   |::|::..|.   |.|||..|  |....:::....:..|||
Yeast     1 MAPKKSTTKTTSKGKKPATSK---GKEKSTSKAAIKKTTAKKEEA--SSKSYRELIIEGLTALKE 60

  Fly    63 RGGSSLLAIKKYITATYKC--DAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEK 125
            |.|||..|:||:|...|..  .|.....:....:|..|..|...|.  ||.:|:.||:    |:|
Yeast    61 RKGSSRPALKKFIKENYPIVGSASNFDLYFNNAIKKGVEAGDFEQP--KGPAGAVKLA----KKK 119

  Fly   126 DPKAKSKVLSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVATKKTAENKKTEKAKAKD 190
            .|:.|.     ||:|                        .||.|:                    
Yeast   120 SPEVKK-----EKEV------------------------SPKPKQ-------------------- 135

  Fly   191 AKKTGIIKSKPAATKAKVTAAKPKAVIAKASKAKPAVSAKPKKTVKKASVSATAKKPKAKTTAAK 255
                       |||....||:|.||...|.:         |||.|||.|.:.||||..:.::...
Yeast   136 -----------AATSVSATASKAKAASTKLA---------PKKVVKKKSPTVTAKKASSPSSLTY 180

  Fly   256 K 256
            |
Yeast   181 K 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33834NP_001027334.1 Linker_histone 46..118 CDD:278939 21/73 (29%)
HHO1NP_015198.1 Linker_histone 44..116 CDD:395429 21/73 (29%)
Linker_histone 179..250 CDD:395429 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4012
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55300
OrthoFinder 1 1.000 - - FOG0000079
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11467
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.