DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33834 and Hils1

DIOPT Version :9

Sequence 1:NP_001027334.1 Gene:His1:CG33834 / 3771911 FlyBaseID:FBgn0053834 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001103035.1 Gene:Hils1 / 690026 RGDID:1585185 Length:169 Species:Rattus norvegicus


Alignment Length:169 Identity:45/169 - (26%)
Similarity:82/169 - (48%) Gaps:29/169 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PATVEKKVGQKKASGSAGTKAKKASATPSHPPTQQMGDASIKNLKERG---GSSLLAIKKYITAT 78
            |:..|.|:|...|:.:.            ..||  |....::.:.::|   ..||.|:||.::.|
  Rat    26 PSQSESKIGPNVATQTL------------RKPT--MSKVILRTVADKGVHSRVSLAALKKAVSIT 76

  Fly    79 YKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDPKAKSKVLSAEKKVQSK 143
            ....||....| |:.|::.|..|.|.|..||||||||:|.    |::..|:|.|   |:::.:.:
  Rat    77 GYNMAQNTWRF-KRVLQNLVKKGMLKQVTGKGASGSFRLG----KKQAFKSKCK---AKRRQRRQ 133

  Fly   144 KVASKKIGVSSKKTAVGAADKKPKAKKAVATKKTAENKK 182
            |...::.|  |:::.:|:  ||...:.....::.|:.::
  Rat   134 KPGQRRTG--SRRSLLGS--KKSNNRLFKGVRRVAKGRR 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33834NP_001027334.1 Linker_histone 46..118 CDD:278939 27/74 (36%)
Hils1NP_001103035.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36 4/9 (44%)
Linker_histone 44..115 CDD:395429 27/73 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 118..154 10/42 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.