DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33834 and H1f10

DIOPT Version :9

Sequence 1:NP_001027334.1 Gene:His1:CG33834 / 3771911 FlyBaseID:FBgn0053834 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_575600.1 Gene:H1f10 / 500252 RGDID:1565596 Length:192 Species:Rattus norvegicus


Alignment Length:243 Identity:67/243 - (27%)
Similarity:97/243 - (39%) Gaps:65/243 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 AAPPATVE---KKVGQKKASGSAG-TKAKKASATPSHPPTQ--QMGDASIKNLKERGGSSLLAIK 72
            |.||.:.:   :|..  ||||||. |:.|:......:.|.:  |:...:|:.|.|||||||..|.
  Rat     8 ALPPTSADGTARKTA--KASGSAAPTQPKRRKNRKKNQPGKYSQLVVETIRKLGERGGSSLARIY 70

  Fly    73 KYITATYKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDPKAKSKVLSAE 137
            .........|.|....::|..:::.|.|..|:|.||.||:|||||:                  .
  Rat    71 AEARKVAWFDQQNGRTYLKYSIRALVQNDTLLQVKGTGANGSFKLN------------------R 117

  Fly   138 KKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVATKKTAENKKTEKAKAKDAKKTGIIKSKPA 202
            ||::         |.:.|:.|..|:...|||:.|                              |
  Rat   118 KKLE---------GSAEKRGASAASSPAPKARTA------------------------------A 143

  Fly   203 ATKAKVTAAKPKAVIAKASKAKPAVSAKPKKTVKKASVSATAKKPKAK 250
            |..|..|.|:|:.........|.|.:|...|.||||:..:..|.||.:
  Rat   144 AAAADRTPARPQPERRAQKSKKAAAAAASTKKVKKAAKPSVPKVPKGR 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33834NP_001027334.1 Linker_histone 46..118 CDD:278939 27/73 (37%)
H1f10XP_575600.1 Linker_histone 46..116 CDD:278939 26/69 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11467
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.