DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33834 and h1m

DIOPT Version :9

Sequence 1:NP_001027334.1 Gene:His1:CG33834 / 3771911 FlyBaseID:FBgn0053834 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_005174537.2 Gene:h1m / 327403 ZFINID:ZDB-GENE-030131-5614 Length:290 Species:Danio rerio


Alignment Length:261 Identity:82/261 - (31%)
Similarity:114/261 - (43%) Gaps:30/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 AAPPATVEKK-----VGQKKASGSAGTKAKKASATPSHPPTQQMGDASIKNLKERGGSSLLAIKK 73
            |.|.||:.|.     ...|.|...:..|:.....:| ||.|.:|...::|.|..|.|.|..||:.
Zfish    42 AEPTATITKSSENETTETKPAPEDSNAKSAARKVSP-HPSTMEMVKEALKELDSRKGVSAQAIRG 105

  Fly    74 YITATY-KCDAQKLAPFIKKYLKSAVVNGKLIQTKGK----GASGSFKLSASAKKEKDPKAKSKV 133
            ||...| ..|..:|...:::.|...:..|..::....    ||.|.|:::|.. |.|:.||:||.
Zfish   106 YIKEKYTTVDETRLKYMVRRALNKGMDTGVFVRPANSGSTTGAQGRFRIAAKT-KAKEAKAQSKE 169

  Fly   134 LSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAV---ATKKTAENKKTEKAKAKDAKKTG 195
            .:...:.::.|....|   ::|....||..:||..||..   |..||:|...| .:|...|||. 
Zfish   170 NADPNEPKATKPKKAK---ATKAKGEGATKEKPTKKKETTDDAKPKTSEQNGT-ASKVAPAKKP- 229

  Fly   196 IIKSKPAATKAKVTAAKPKAVIAKASK---AKPAVSAKPKKTVKKA--SVSATAKKPKAKTTAAK 255
              |:|.||.:.   .||||...|||||   .:||.....||...||  ..|..|...||....||
Zfish   230 --KAKNAAGEG---GAKPKPSKAKASKEGAEEPAAKKGGKKNAVKAEDGESGAAATEKAPGKRAK 289

  Fly   256 K 256
            |
Zfish   290 K 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33834NP_001027334.1 Linker_histone 46..118 CDD:278939 22/76 (29%)
h1mXP_005174537.2 Linker_histone 78..154 CDD:306920 22/75 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.