DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His1:CG33834 and Hp1bp3

DIOPT Version :9

Sequence 1:NP_001027334.1 Gene:His1:CG33834 / 3771911 FlyBaseID:FBgn0053834 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_038965988.1 Gene:Hp1bp3 / 313647 RGDID:735099 Length:578 Species:Rattus norvegicus


Alignment Length:347 Identity:87/347 - (25%)
Similarity:124/347 - (35%) Gaps:124/347 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VEKKVGQKKASGSAGTKAKKASATPSHPPTQQMGDA---------------SIKNLKERGGSSLL 69
            |.|:|..|.||||.....|  |.||.....::.|.|               :...|.|...:|..
  Rat   240 VIKQVKGKGASGSFVVVQK--SKTPQKSKNRKKGSAVDPEPQVKLEDVLPLAFTRLCEPKEASYS 302

  Fly    70 AIKKYITATYKCDAQKLAP-FIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKE--------- 124
            .|:||::..|......:.| .:|..|:.||..|:|.|..||||||:|:|..|.:|.         
  Rat   303 LIRKYVSQYYPKLRVDIRPQLLKNALQRAVERGQLEQITGKGASGTFQLKKSGEKPLLGGSLMEY 367

  Fly   125 ---------KDPKA--------------------------KSKVLSAEKKVQSKKVASKKIGVSS 154
                     .:||.                          |..:...||....::::.|  |.|.
  Rat   368 AILSAIAAMNEPKTCSTTALKKYVLENHPGTNSNYQMHLLKKTLQKCEKNGWLEQISGK--GFSG 430

  Fly   155 -----------------KKTAVG----------------AADKKPKAKKAVATKKTAENK-KTEK 185
                             ||.:.|                :.|::|..|:::..|..|:.: ||..
  Rat   431 TFQLCFPYYPSPGVLFPKKVSDGSEDEDEEEDEEESSEDSEDEEPPPKRSLQKKTPAKPQGKTAS 495

  Fly   186 AKAKDAKKTGIIKSKPAATKAKV----TAAKPKAVIAKASKAKPAVSAKPKKTVKKASVSATAKK 246
            .|.:.||..   :..|||.:.||    ..|.|||. ..|.|.:||.||     |||.| .:|:||
  Rat   496 MKQRGAKPA---RKVPAAQRGKVRPLPKKAPPKAK-TPARKGRPAPSA-----VKKPS-GSTSKK 550

  Fly   247 P------------KAKTTAAKK 256
            |            |.|:...||
  Rat   551 PVANARKEAKLPGKGKSAMKKK 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His1:CG33834NP_001027334.1 Linker_histone 46..118 CDD:278939 24/87 (28%)
Hp1bp3XP_038965988.1 H15 180..264 CDD:238028 12/25 (48%)
H15 276..342 CDD:197772 15/65 (23%)
Linker_histone 369..434 CDD:395429 8/66 (12%)
valS <479..555 CDD:237855 30/85 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.